PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G235800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB
Protein Properties Length: 454aa    MW: 50595.1 Da    PI: 7.9933
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G235800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-171461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
  Manes.01G235800.1.p 14 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                         678*******************************************97 PP

2Myb_DNA-binding44.34.1e-1467110146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          rg ++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Manes.01G235800.1.p  67 RGTFSQQEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                          899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-28664IPR009057Homeodomain-like
PROSITE profilePS5129425.116965IPR017930Myb domain
SuperFamilySSF466894.03E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002493.4E-151461IPR001005SANT/Myb domain
CDDcd001678.28E-121761No hitNo description
Gene3DG3DSA:1.10.10.603.3E-2565116IPR009057Homeodomain-like
SMARTSM007177.8E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129420.40366116IPR017930Myb domain
PfamPF002494.3E-1367111IPR001005SANT/Myb domain
CDDcd001677.69E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQQEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPVTHKPLS EVENNGQDKN PPANKSQEKA SGVSNELNLL EANNSKPGPT SQEKTQSYHL  180
EGKGSSNSKT MSSNTNNHSN NSNLMSPISN KDFFLERFAT SHHEGSTTNC QPSDLVGHFP  240
LQQLNYASNS RLVTNSIPSH WFTQTSKSLD MNSEFSSSSI PTILPPTTSS FLSTSMPFKP  300
SVTVPSDDPS LASFPINSSR FWEAVALSNN SNSSTGSSGN AELQSTFFES TIFSWGLGDC  360
SSTEKEGQNQ LMGSQQEDVK WPEYLHNPLI MAAALQNQSL PQSLYNEIKS ETHFLTQNSS  420
AVWPQNQQQQ EPFQNSDICP KDIQRLTAAY GHI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572455.10.0PREDICTED: transcription factor MYB86
TrEMBLB9I9970.0B9I997_POPTR; Uncharacterized protein
STRINGPOPTR_0014s10680.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.31e-95myb domain protein 55